Reputation: 121
Alright, I'm working on a little project for school, a 6-frame translator. I won't go into too much detail, I'll just describe what I wanted to add. The normal output would be something like:
TTCPTISPALGLAWS_DLGTLGFMSYSANTASGETLVSLYQLGLFEM_VVSYGRTKYYLICP_LFHLSVGFVPSD
The important part of this string are the M and the _ (the start and stop codons, biology stuff). What I wanted to do was highlight these like so:
TTCPTISPALGLAWS_DLGTLGF 'MSYSANTASGETLVSLYQLGLFEM_' VVSYGRTKYYLICP_LFHLSVGFVPSD
Now here is where (for me) it gets tricky, I got my output to look like this (adding a space and a '
to highlight the start and stop). But it only does this once, for the first start and stop it finds. If there are any other M....._ combinations it won't highlight them.
Here is my current code, attempting to make it highlight more than once:
def start_stop(translation):
index_2 = 0
while True:
if 'M' in translation[index_2::1]:
index_1 = translation[index_2::1].find('M')
index_2 = translation[index_1::1].find('_') + index_1
new_translation = translation[:index_1] + " '" + \
translation[index_1:index_2 + 1] + "' " +\
translation[index_2 + 1:]
else:
break
return new_translation
I really thought this would do it, guess not. So now I find myself being stuck. If any of you are willing to try and help, here is a randomly generated string with more than one M....._ set:
'TTCPTISPALGLAWS_DLGTLGFMSYSANTASGETLVSLYQLGLFEM_VVSYGRTKYYLICP_LFHLSVGFVPSDGRRLTLYMPPARRLATKSRFLTPVISSG_DKPRHNPVARSQFLNPLVRPNYSISASKSGLRLVLSYTRLSLGINSLPIERLQYSVPAPAQITP_IPEHGNARNFLPEWPRLLISEPAPSVNVPCSVFVVDPEHPKAHSKPDGIANRLTFRWRLIG_VFFHNAL_VITHGYSRVDILLPVSRALHVHLSKSLLLRSAWFTLRNTRVTGKPQTSKT_FDPKATRVHAIDACAE_QQH_PDSGLRFPAPGSCSEAIRQLMI'
Thank you to anyone willing to help :)
Upvotes: 3
Views: 522
Reputation: 12669
You just require little slice of 'slice' module , you don't need any external module :
Python string have a method called 'index' just use it.
string_1='TTCPTISPALGLAWS_DLGTLGFMSYSANTASGETLVSLYQLGLFEM_VVSYGRTKYYLICP_LFHLSVGFVPSD'
before=string_1.index('M')
after=string_1[before:].index('_')
print('{} {} {}'.format(string_1[:before],string_1[before:before+after+1],string_1[before+after+1:]))
output:
TTCPTISPALGLAWS_DLGTLGF MSYSANTASGETLVSLYQLGLFEM_ VVSYGRTKYYLICP_LFHLSVGFVPSD
Upvotes: 0
Reputation: 47770
Regular expressions are pretty handy here:
import re
sequence = "TTCP...."
highlighted = re.sub(r"(M\w*?_)", r" '\1' ", sequence)
# Output:
"TTCPTISPALGLAWS_DLGTLGF 'MSYSANTASGETLVSLYQLGLFEM_' VVSYGRTKYYLICP_LFHLSVGFVPSDGRRLTLY 'MPPARRLATKSRFLTPVISSG_' DKPRHNPVARSQFLNPLVRPNYSISASKSGLRLVLSYTRLSLGINSLPIERLQYSVPAPAQITP_IPEHGNARNFLPEWPRLLISEPAPSVNVPCSVFVVDPEHPKAHSKPDGIANRLTFRWRLIG_VFFHNAL_VITHGYSRVDILLPVSRALHVHLSKSLLLRSAWFTLRNTRVTGKPQTSKT_FDPKATRVHAIDACAE_QQH_PDSGLRFPAPGSCSEAIRQLMI"
Regex explanation:
We look for an M
followed by any number of "word characters" \w*
then an _
, using the ?
to make it a non-greedy match (otherwise it would just make one group from the first M
to the last _
).
The replacement is the matched group (\1
indicates "first group", there's only one), but surrounded by spaces and quotes.
Upvotes: 4