CODEWITHSUNDEEP
pythonflasksqlalchemyflask-sqlalchemy
anvd
anvd

Reputation: 4047

OR operator wth multiple combinations

I am trying to use this code as OR operator with flask and sql alchemy.

.filter(
(Model.c != True, Model.d == None ) 
| 
(Model.c == True, Model.d != None ) 
)

TypeError: unsupported operand type(s) for |: 'tuple' and 'tuple'

However it seems this syntax only works with one parameter. Something like works fine:

.filter((Model.a != X) | (Model.a == Y))

So my question is how can I add a filter condition to select the combination of the first sequence or the second.

Upvotes: 0

Views: 95

Answers (2)

Le Minaw
Le Minaw

Reputation: 885

With only commas, you're using the | operator on two tuples, wich is unsupported.

You need to use SQLAlchemy and_ function:

from sqlalchemy import and_
filter(and_(x == 'a', y == 'b'))

Quick edit: you can chain it with, for exemple, or_ to achieve something like this:

from sqlalchemy import or_, and_
filter(
    or_(
        and_(x == 'a', y == 'b'),
        and_(x == 'c', y == 'd')
    )
)

Upvotes: 1

Achyut-BK
Achyut-BK

Reputation: 65

Your mistake lies with the comma you used. When you used the comma, python interprets your code as a tuple of booleans. You can't pass such tuples through or. you should connect the two conditions with a boolean operator like and or and not, to form a boolean answer that can be passed through the or operator

Upvotes: 0

Related Questions