Reputation: 153
I wrote a small script in python to concatenate some lines from different files into one file. But somehow it doesn't print anything I like it to print by the function I wrote. I tried to spot the problems, but after one evening and one morning, I still can't find the problem. Could somebody help me please? Thanks a lot!
So I have a folder where around thousands of .fa files are. In each of the .fa file, I would like to extract the line starting with ">", and also do some change to extract the information I like. In the end, I would like to combine all the information extracted from one file into one line in a new file, and then concatenate all the information from all the .fa file into one .txt file.
So the folder:
% ls
EstimatedSpeciesTree.nwk HOG9998.fa concatenate_gene_list_HOG.py
HOG9997.fa HOG9999.fa output
One .fa file for example
>BnaCnng71140D [BRANA]
MTSSFKLSDLEEVTTNAEKIQNDLLKEILTLNAKTEYLRQFLHGSSDKTFFKKHVPVVSYEDMKPYIERVADGEPSEIIS
GGPITKFLRRYSF
>Cadbaweo98702.t [THATH]
MTSSFKLSDLEEVTTNAEKIQNDLLKEILTLNAKTEYLRQFLHGSSDKTFFKKHVPVVSYEDMKPYIERVADGEPSEIIS
GGPITKFLRRYSF
What I would like to have is one file like this
HOG9997.fa BnaCnng71140D:BRANA Cadbaweo98702.t:THATH
HOG9998.fa Bkjfnglks098:BSFFE dsgdrgg09769.t
HOG9999.fa Dsdfdfgs1937:XDGBG Cadbaweo23425.t:THATH Dkkjewe098.t:THUGB
# NOTE: the number of lines in each .fa file are uncertain. Also, some lines has [ ], but some lines has not.
So my code is
#!/usr/bin/env python3
import os
import re
import csv
def concat_hogs(a_file):
output = []
for row in a_file: # select the gene names in each HOG fasta file
if row.startswith(">"):
trans = row.partition(" ")[0].partition(">")[2]
if row.partition(" ")[2].startswith("["):
species = re.search(r"\[(.*?)\]", row).group(1)
else:
species = ""
output.append(trans + ":" + species)
return '\t'.join(output)
folder = "/tmp/Fasta/"
print("Concatenate names in " + folder)
for file in os.listdir(folder):
if file.endswith('.fa'):
reader = csv.reader(file, delimiter="\t")
print(file + concat_hogs(reader))
But the output only prints the file name with out the part that should be generated by the function concat_hogs(file)
. I don't understand why.
Upvotes: 1
Views: 589
Reputation: 18488
The error comes from you passing the name of the file to your concat_hogs
function instead of an iterable file handle. You are missing the actual opening of the file for reading purposes.
I agree with Jay M that your code can be simplified drastically, not least by using regular expressions more efficiently. Also pathlib
is awesome.
But I think it can be even more concise and expressive. Here is my suggestion:
#!/usr/bin/env python3
import re
from pathlib import Path
GENE_PATTERN = re.compile(
r"^>(?P<trans>[\w.]+)\s+(?:\[(?P<species>\w+)])?"
)
def extract_gene(string: str) -> str:
match = re.search(GENE_PATTERN, string)
return ":".join(match.groups(default=""))
def concat_hogs(file_path: Path) -> str:
with file_path.open("r") as file:
return '\t'.join(
extract_gene(row)
for row in file
if row.startswith(">")
)
def main() -> None:
folder = Path("/tmp/Fasta/")
print("Concatenate names in", folder)
for element in folder.iterdir():
if element.is_file() and element.suffix == ".fa":
print(element.name, concat_hogs(element))
if __name__ == '__main__':
main()
I am using named capturing groups for the regular expression because I prefer it for readability and usability later on.
Also I assume that the first group can only contain letters, digits and dots. Adjust the pattern, if there are more options.
Just to add a few additional explanations:
The pathlib
module is a great tool for any basic filesystem-related task. Among a few other useful methods you can look up there, I use the Path.iterdir
method, which just iterates over elements in that directory instead of creating an entire list of them in memory first the way os.listdir
does.
The RegEx Match.groups
method returns a tuple of the matched groups, the default
parameter allows setting the value when a group was not matched. I put an empty string there, so that I can always simply str.join
the groups, even if the species
-group was not found. Note that this .groups
call will result in an AttributeError
, if no match was found because then the match
variable will be set to None
. It may or may not be useful for you to catch this error.
For a few additional pointers about using regular expressions in Python, there is a great How-To-Guide in the docs. In addition I can only agree with Jay M about how useful regex101.com is, regardless of language specifics. Also, I think I would recommend using his approach of reading the entire file into memory as a single string first and then using re.findall
on it to grab all matches at once. That is probably much more efficient than going line-by-line, unless you are dealing with gigantic files.
In concat_hogs
I pass a generator expression to str.join
. This is more efficient than first creating a list and passing that to join
because no additional memory needs to be allocated. This is possible because str.join
accepts any iterable of strings and that generator expression (... for ... in ...)
returns a Generator
, which inherits from Iterator
and thus from Iterable
. For more insight about the container inheritance structures I always refer to the collections.abc
docs.
Upvotes: 2
Reputation: 4297
Use standard Python libraries
In this case
A breakdown of the regex used here:
>([a-z0-9A-Z\.]+?)\s*(\n|\[([A-Z]+)\]?\n)
>
The start of block character(regex1)
First matchig block\s*
Any amount of whitespace (i.e. zero space is ok)(regex2|regex3)
A choice of two possible regex+
= One or more of characters in [class]
Where class is any a to z or 0 to 9 or a dot\n
= A newline that immediately follows the whitespaceNote1: The brackets create capture groups, which we later use to split out the fields.
Note2: The regex demands zero or more whitespace between the first and second part of the text line, this makes it more resiliant.
import re
from collections import namedtuple
from pathlib import Path
import os
class HOG(namedtuple('HOG', ['filepath', 'filename', 'key', 'text'], defaults=[None])):
__slots__ = ()
def __str__(self):
return f"{self.key}:{self.text}"
regex = re.compile(r">([a-z0-9A-Z\.]+?)\s*(\n|\[([A-Z]+)\]?\n)")
path = Path(os.path.abspath("."))
wildcard = "*.fa"
files = list(path.glob("*.fa"))
print(f"Searching {path}/{wildcard} => found {len(files)} files")
data = {}
for file in files:
print(f"Processing {file}")
with file.open() as hf:
text = hf.read(-1)
matches = regex.findall(text)
for match in matches:
key = match[0].strip()
text = match[-1].strip()
if file.name not in data:
data[file.name] = []
data[file.name].append(HOG(path, file.name, key, text))
print("Now you have the data you can process it as you like")
for file, entries in data.items():
line = "\t".join(list(str(e) for e in entries))
print(file, line)
# e.g. Write the output as desired
with Path("output").open("w") as fh:
for file, entries in data.items():
line = "\t".join(list(str(e) for e in entries))
fh.write(f"{file}\t{line}\n")
Upvotes: 2